PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_286F71214.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family B3
Protein Properties Length: 80aa    MW: 9096.45 Da    PI: 10.1699
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_286F71214.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B333.86.2e-1121585895
                           EEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                     B3 58 ryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95
                            ++lt+GW++Fv+an++++gD ++F + grs+f+ ++k
  Traes_4AL_286F71214.1 21 LITLTTGWRHFVDANHIRQGDPIMFVYCGRSTFKVHFK 58
                           478******************************88776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086310.574161IPR003340B3 DNA binding domain
CDDcd100179.77E-8257No hitNo description
PfamPF023622.3E-8358IPR003340B3 DNA binding domain
SuperFamilySSF1019361.8E-101357IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.0E-92057IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
PIKLETPDIH VYSVEFVKFG LITLTTGWRH FVDANHIRQG DPIMFVYCGR STFKVHFKGT  60
PSGHKNSLPS SQQPPNIFRA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW5DMJ39e-55W5DMJ3_WHEAT; Uncharacterized protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]